| Name | VMD2L2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1494 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | VMD2L2 antibody was raised using the N terminal Of Vmd2L2 corresponding to a region with amino acids MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | VMD2L2 Blocking Peptide |
| Description | Rabbit polyclonal VMD2L2 antibody raised against the N terminal Of Vmd2L2 |
| Gene | BEST4 |
| Supplier Page | Shop |