Name | Claudin 15 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1688 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Claudin 15 antibody was raised using the C terminal of CLDN15 corresponding to a region with amino acids LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | Claudin 15 Blocking Peptide |
Description | Rabbit polyclonal Claudin 15 antibody raised against the C terminal of CLDN15 |
Gene | CLDN15 |
Supplier Page | Shop |