Claudin 15 antibody

Name Claudin 15 antibody
Supplier Fitzgerald
Catalog 70R-1688
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Claudin 15 antibody was raised using the C terminal of CLDN15 corresponding to a region with amino acids LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
Purity/Format Total IgG Protein A purified
Blocking Peptide Claudin 15 Blocking Peptide
Description Rabbit polyclonal Claudin 15 antibody raised against the C terminal of CLDN15
Gene CLDN15
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.