| Name | ACTL6B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3899 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ACTL6B antibody was raised using the middle region of ACTL6B corresponding to a region with amino acids GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACTL6B Blocking Peptide |
| Description | Rabbit polyclonal ACTL6B antibody raised against the middle region of ACTL6B |
| Gene | ACTL6B |
| Supplier Page | Shop |