Name | TPD52 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3391 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | TPD52 antibody was raised using the middle region of TPD52 corresponding to a region with amino acids AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG |
Purity/Format | Affinity purified |
Blocking Peptide | TPD52 Blocking Peptide |
Description | Rabbit polyclonal TPD52 antibody raised against the middle region of TPD52 |
Gene | TPD52 |
Supplier Page | Shop |