| Name | TPD52 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3391 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TPD52 antibody was raised using the middle region of TPD52 corresponding to a region with amino acids AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG |
| Purity/Format | Affinity purified |
| Blocking Peptide | TPD52 Blocking Peptide |
| Description | Rabbit polyclonal TPD52 antibody raised against the middle region of TPD52 |
| Gene | TPD52 |
| Supplier Page | Shop |