| Name | Involucrin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2846 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Involucrin antibody was raised using the N terminal of IVL corresponding to a region with amino acids AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE |
| Purity/Format | Affinity purified |
| Blocking Peptide | Involucrin Blocking Peptide |
| Description | Rabbit polyclonal Involucrin antibody raised against the N terminal of IVL |
| Gene | IVL |
| Supplier Page | Shop |