| Name | SMN1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4672 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | SMN1 antibody was raised using the N terminal of SMN1 corresponding to a region with amino acids KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV |
| Purity/Format | Affinity purified |
| Blocking Peptide | SMN1 Blocking Peptide |
| Description | Rabbit polyclonal SMN1 antibody raised against the N terminal of SMN1 |
| Gene | SMN1 |
| Supplier Page | Shop |