| Name | C9ORF96 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1210 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C9ORF96 antibody was raised using the C terminal Of C9Orf96 corresponding to a region with amino acids AFKVVVQEEGGSGLSLIKETYQLHRDDPEVVENVGMLLVHLASYEEILPE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | C9ORF96 Blocking Peptide |
| Description | Rabbit polyclonal C9ORF96 antibody raised against the C terminal Of C9Orf96 |
| Gene | STKLD1 |
| Supplier Page | Shop |