IL13RA2 antibody

Name IL13RA2 antibody
Supplier Fitzgerald
Catalog 70R-1949
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL
Purity/Format Affinity purified
Blocking Peptide IL13RA2 Blocking Peptide
Description Rabbit polyclonal IL13RA2 antibody raised against the N terminal of IL13RA2
Gene IL13
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.