| Name | IL13RA2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1949 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | IL13RA2 Blocking Peptide |
| Description | Rabbit polyclonal IL13RA2 antibody raised against the N terminal of IL13RA2 |
| Gene | IL13 |
| Supplier Page | Shop |