| Name | G22P1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1050 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | G22P1 antibody was raised using the N terminal Of G22P1 corresponding to a region with amino acids MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | G22P1 Blocking Peptide |
| Description | Rabbit polyclonal G22P1 antibody raised against the N terminal Of G22P1 |
| Gene | XRCC6 |
| Supplier Page | Shop |