| Name | C11ORF54 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3456 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | C11ORF54 antibody was raised using the N terminal Of C11Orf54 corresponding to a region with amino acids CPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEI |
| Purity/Format | Affinity purified |
| Blocking Peptide | C11ORF54 Blocking Peptide |
| Description | Rabbit polyclonal C11ORF54 antibody raised against the N terminal Of C11Orf54 |
| Gene | C11orf54 |
| Supplier Page | Shop |