PRSS35 antibody

Name PRSS35 antibody
Supplier Fitzgerald
Catalog 70R-5474
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PRSS35 antibody was raised using the N terminal of PRSS35 corresponding to a region with amino acids PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG
Purity/Format Affinity purified
Blocking Peptide PRSS35 Blocking Peptide
Description Rabbit polyclonal PRSS35 antibody raised against the N terminal of PRSS35
Gene PRSS35
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.