NDUFV1 antibody

Name NDUFV1 antibody
Supplier Fitzgerald
Catalog 70R-1114
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen NDUFV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG
Purity/Format Total IgG Protein A purified
Blocking Peptide NDUFV1 Blocking Peptide
Description Rabbit polyclonal NDUFV1 antibody
Gene NDUFV1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.