CACNB3 antibody

Name CACNB3 antibody
Supplier Fitzgerald
Catalog 70R-5061
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen CACNB3 antibody was raised using the N terminal of CACNB3 corresponding to a region with amino acids MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ
Purity/Format Affinity purified
Blocking Peptide CACNB3 Blocking Peptide
Description Rabbit polyclonal CACNB3 antibody raised against the n terminal of CACNB3
Gene CACNB3
Supplier Page Shop