| Name | RAB15 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5831 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAB15 Blocking Peptide |
| Description | Rabbit polyclonal RAB15 antibody raised against the N terminal of RAB15 |
| Gene | RAB15 |
| Supplier Page | Shop |