GRSF1 antibody

Name GRSF1 antibody
Supplier Fitzgerald
Catalog 70R-4773
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen GRSF1 antibody was raised using the middle region of GRSF1 corresponding to a region with amino acids IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV
Purity/Format Affinity purified
Blocking Peptide GRSF1 Blocking Peptide
Description Rabbit polyclonal GRSF1 antibody raised against the middle region of GRSF1
Gene GRSF1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.