Name | BHMT antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1220 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | BHMT antibody was raised using the N terminal of BHMT corresponding to a region with amino acids AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | BHMT Blocking Peptide |
Description | Rabbit polyclonal BHMT antibody raised against the N terminal of BHMT |
Gene | BHMT |
Supplier Page | Shop |