| Name | CARF antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1349 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | CARF antibody was raised using the C terminal Of Carf corresponding to a region with amino acids AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CARF Blocking Peptide |
| Description | Rabbit polyclonal CARF antibody raised against the C terminal Of Carf |
| Gene | CDKN2AIP |
| Supplier Page | Shop |