| Name | MAP7D1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4362 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MAP7D1 antibody was raised using the N terminal of MAP7D1 corresponding to a region with amino acids RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | MAP7D1 Blocking Peptide |
| Description | Rabbit polyclonal MAP7D1 antibody raised against the N terminal of MAP7D1 |
| Gene | MAP7 |
| Supplier Page | Shop |