ANKRD47 antibody

Name ANKRD47 antibody
Supplier Fitzgerald
Catalog 70R-4426
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids MAKFALNQNLPDLGGPRLCPVPAAGGARSPSSPYSVETPYGFHLDLDFLK
Purity/Format Affinity purified
Blocking Peptide ANKRD47 Blocking Peptide
Description Rabbit polyclonal ANKRD47 antibody raised against the N terminal Of Ankrd47
Gene KANK3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.