PRPF4 antibody

Name PRPF4 antibody
Supplier Fitzgerald
Catalog 70R-4650
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PRPF4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT
Purity/Format Affinity purified
Blocking Peptide PRPF4 Blocking Peptide
Description Rabbit polyclonal PRPF4 antibody
Gene PRPF4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.