| Name | KCNK9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5199 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KCNK9 antibody was raised using the N terminal of KCNK9 corresponding to a region with amino acids REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNK9 Blocking Peptide |
| Description | Rabbit polyclonal KCNK9 antibody raised against the N terminal of KCNK9 |
| Gene | KCNK9 |
| Supplier Page | Shop |