| Name | FAM83F antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4143 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FAM83F antibody was raised using the middle region of FAM83F corresponding to a region with amino acids FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM83F Blocking Peptide |
| Description | Rabbit polyclonal FAM83F antibody raised against the middle region of FAM83F |
| Gene | FAM83F |
| Supplier Page | Shop |