Name | FAM83F antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4143 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | FAM83F antibody was raised using the middle region of FAM83F corresponding to a region with amino acids FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP |
Purity/Format | Affinity purified |
Blocking Peptide | FAM83F Blocking Peptide |
Description | Rabbit polyclonal FAM83F antibody raised against the middle region of FAM83F |
Gene | FAM83F |
Supplier Page | Shop |