Name | FAM29A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3438 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FAM29A antibody was raised using the middle region of Fam29A corresponding to a region with amino acids RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT |
Purity/Format | Affinity purified |
Blocking Peptide | FAM29A Blocking Peptide |
Description | Rabbit polyclonal FAM29A antibody raised against the middle region of Fam29A |
Gene | HAUS6 |
Supplier Page | Shop |