| Name | NANP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4175 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | NANP antibody was raised using the middle region of NANP corresponding to a region with amino acids VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS |
| Purity/Format | Affinity purified |
| Blocking Peptide | NANP Blocking Peptide |
| Description | Rabbit polyclonal NANP antibody raised against the middle region of NANP |
| Gene | NANP |
| Supplier Page | Shop |