Name | PEX10 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6974 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | PEX10 antibody was raised using the C terminal of PEX10 corresponding to a region with amino acids ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR |
Purity/Format | Affinity purified |
Blocking Peptide | PEX10 Blocking Peptide |
Description | Rabbit polyclonal PEX10 antibody raised against the C terminal of PEX10 |
Gene | PEX10 |
Supplier Page | Shop |