GNB1 antibody

Name GNB1 antibody
Supplier Fitzgerald
Catalog 70R-3118
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD
Purity/Format Affinity purified
Blocking Peptide GNB1 Blocking Peptide
Description Rabbit polyclonal GNB1 antibody
Gene GNB1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.