| Name | CYP2D6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1868 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse |
| Antigen | CYP2D6 antibody was raised using the N terminal of CYP2D6 corresponding to a region with amino acids RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CYP2D6 Blocking Peptide |
| Description | Rabbit polyclonal CYP2D6 antibody raised against the N terminal of CYP2D6 |
| Gene | CYP2D6 |
| Supplier Page | Shop |