Name | NNMT antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1262 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | NNMT Blocking Peptide |
Description | Rabbit polyclonal NNMT antibody raised against the N terminal of NNMT |
Gene | NNMT |
Supplier Page | Shop |