HERC6 antibody

Name HERC6 antibody
Supplier Fitzgerald
Catalog 70R-2770
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen HERC6 antibody was raised using the N terminal of HERC6 corresponding to a region with amino acids LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH
Purity/Format Affinity purified
Blocking Peptide HERC6 Blocking Peptide
Description Rabbit polyclonal HERC6 antibody raised against the N terminal of HERC6
Gene HERC6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.