CCRL2 antibody

Name CCRL2 antibody
Supplier Fitzgerald
Catalog 70R-5949
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CCRL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL
Purity/Format Affinity purified
Blocking Peptide CCRL2 Blocking Peptide
Description Rabbit polyclonal CCRL2 antibody
Gene EIF2AK1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.