| Name | C9ORF127 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1846 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | C9ORF127 antibody was raised using the middle region of C9Orf127 corresponding to a region with amino acids THNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | C9ORF127 Blocking Peptide |
| Description | Rabbit polyclonal C9ORF127 antibody raised against the middle region of C9Orf127 |
| Gene | TMEM8B |
| Supplier Page | Shop |