| Name | LAPTM4A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1814 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | LAPTM4A antibody was raised using the middle region of LAPTM4A corresponding to a region with amino acids VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | LAPTM4A Blocking Peptide |
| Description | Rabbit polyclonal LAPTM4A antibody raised against the middle region of LAPTM4A |
| Gene | LAPTM4A |
| Supplier Page | Shop |