| Name | FN3KRP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3288 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FN3KRP antibody was raised using the N terminal of FN3KRP corresponding to a region with amino acids MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA |
| Purity/Format | Affinity purified |
| Blocking Peptide | FN3KRP Blocking Peptide |
| Description | Rabbit polyclonal FN3KRP antibody raised against the N terminal of FN3KRP |
| Gene | FN3KRP |
| Supplier Page | Shop |