| Name | RNF165 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2743 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RNF165 antibody was raised using the middle region of RNF165 corresponding to a region with amino acids SSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLG |
| Purity/Format | Affinity purified |
| Blocking Peptide | RNF165 Blocking Peptide |
| Description | Rabbit polyclonal RNF165 antibody raised against the middle region of RNF165 |
| Gene | RNF165 |
| Supplier Page | Shop |