| Name | TBCB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3673 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI |
| Purity/Format | Affinity purified |
| Blocking Peptide | TBCB Blocking Peptide |
| Description | Rabbit polyclonal TBCB antibody raised against the C terminal of TBCB |
| Gene | TBCB |
| Supplier Page | Shop |