| Name | PDE3A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6279 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PDE3A antibody was raised using the N terminal of PDE3A corresponding to a region with amino acids LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD |
| Purity/Format | Affinity purified |
| Blocking Peptide | PDE3A Blocking Peptide |
| Description | Rabbit polyclonal PDE3A antibody raised against the N terminal of PDE3A |
| Gene | PDE3A |
| Supplier Page | Shop |