| Name | RPE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4057 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RPE antibody was raised using the N terminal of RPE corresponding to a region with amino acids ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPE Blocking Peptide |
| Description | Rabbit polyclonal RPE antibody raised against the N terminal of RPE |
| Gene | RPE |
| Supplier Page | Shop |