| Name | C13ORF7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2807 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C13ORF7 antibody was raised using the N terminal Of C13Orf7 corresponding to a region with amino acids LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG |
| Purity/Format | Affinity purified |
| Blocking Peptide | C13ORF7 Blocking Peptide |
| Description | Rabbit polyclonal C13ORF7 antibody raised against the N terminal Of C13Orf7 |
| Gene | RNF219 |
| Supplier Page | Shop |