DDX47 antibody

Name DDX47 antibody
Supplier Fitzgerald
Catalog 70R-1369
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR
Purity/Format Total IgG Protein A purified
Blocking Peptide DDX47 Blocking Peptide
Description Rabbit polyclonal DDX47 antibody
Gene DDX47
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.