| Name | KIAA1189 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4446 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KIAA1189 antibody was raised using the middle region of Kiaa1189 corresponding to a region with amino acids RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIAA1189 Blocking Peptide |
| Description | Rabbit polyclonal KIAA1189 antibody raised against the middle region of Kiaa1189 |
| Gene | ERMN |
| Supplier Page | Shop |