| Name | RPS7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4830 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RPS7 antibody was raised using the N terminal of RPS7 corresponding to a region with amino acids MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPS7 Blocking Peptide |
| Description | Rabbit polyclonal RPS7 antibody raised against the N terminal of RPS7 |
| Gene | RPS7 |
| Supplier Page | Shop |