| Name | TNKS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2849 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST |
| Purity/Format | Affinity purified |
| Blocking Peptide | TNKS Blocking Peptide |
| Description | Rabbit polyclonal TNKS antibody raised against the middle region of TNKS |
| Gene | TNKS |
| Supplier Page | Shop |