| Name | FBXL14 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3779 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FBXL14 antibody was raised using the N terminal of FBXL14 corresponding to a region with amino acids WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY |
| Purity/Format | Affinity purified |
| Blocking Peptide | FBXL14 Blocking Peptide |
| Description | Rabbit polyclonal FBXL14 antibody raised against the N terminal of FBXL14 |
| Gene | FBXL14 |
| Supplier Page | Shop |