HIBADH antibody

Name HIBADH antibody
Supplier Fitzgerald
Catalog 70R-2529
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL
Purity/Format Affinity purified
Blocking Peptide HIBADH Blocking Peptide
Description Rabbit polyclonal HIBADH antibody raised against the middle region of HIBADH
Gene HIBADH
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.