| Name | AHCY antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2721 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA |
| Purity/Format | Affinity purified |
| Blocking Peptide | AHCY Blocking Peptide |
| Description | Rabbit polyclonal AHCY antibody raised against the N terminal of AHCY |
| Gene | AHCY |
| Supplier Page | Shop |