SLC43A3 antibody

Name SLC43A3 antibody
Supplier Fitzgerald
Catalog 70R-1888
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen SLC43A3 antibody was raised using the N terminal of SLC43A3 corresponding to a region with amino acids MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD
Purity/Format Total IgG Protein A purified
Blocking Peptide SLC43A3 Blocking Peptide
Description Rabbit polyclonal SLC43A3 antibody raised against the N terminal of SLC43A3
Gene CAPRIN2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.