Name | EIF2S3 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1058 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
Antigen | EIF2S3 antibody was raised using the N terminal of EIF2S3 corresponding to a region with amino acids LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | EIF2S3 Blocking Peptide |
Description | Rabbit polyclonal EIF2S3 antibody raised against the N terminal of EIF2S3 |
Gene | EIF2S3 |
Supplier Page | Shop |