FBXO39 antibody

Name FBXO39 antibody
Supplier Fitzgerald
Catalog 70R-3431
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen FBXO39 antibody was raised using the middle region of FBXO39 corresponding to a region with amino acids RQCALRVFKARIYTNRYETNEEDKTLQEIYRKYRKLIESELSYFVIVYSV
Purity/Format Affinity purified
Blocking Peptide FBXO39 Blocking Peptide
Description Rabbit polyclonal FBXO39 antibody raised against the middle region of FBXO39
Gene FBXO39
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.