MTCH2 antibody

Name MTCH2 antibody
Supplier Fitzgerald
Catalog 70R-2534
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV
Purity/Format Affinity purified
Blocking Peptide MTCH2 Blocking Peptide
Description Rabbit polyclonal MTCH2 antibody
Gene MTCH2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.