C1orf144 antibody

Name C1orf144 antibody
Supplier Fitzgerald
Catalog 70R-4008
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C1orf144 antibody was raised using the N terminal of C1orf144 corresponding to a region with amino acids MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN
Purity/Format Affinity purified
Blocking Peptide C1orf144 Blocking Peptide
Description Rabbit polyclonal C1orf144 antibody raised against the N terminal of C1orf144
Gene SZRD1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.